PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00016582001
Common NameGSBRNA2T00016582001, LOC106432208
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 258aa    MW: 29490.9 Da    PI: 5.9601
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00016582001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.3e-40311311101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ e+++am++++++++ara+dP++G++++i++lq ++e +
  GSBRNA2T00016582001  31 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLSPPEKDAAMHTIMFQSDARANDPIEGCYSIIRRLQYEIEYS 120
                          7***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          k+el++++++l
  GSBRNA2T00016582001 121 KNELDMVHHQL 131
                          *******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.11430131IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3631128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MPSNKPSSIF PLHHKPTPLK PSSSTNTTNQ ACAACKYQRR KCAPDCLLAP YFPHDRHRQF  60
LNAHKLFGVS NITKIIKDLS PPEKDAAMHT IMFQSDARAN DPIEGCYSII RRLQYEIEYS  120
KNELDMVHHQ LAVFRDRAHN HYQEPHMQMQ EPEDLSSSCD LNNNNVVPYS YPLHHVQEPN  180
QQQQQYCSSG NFNGLQEDMW CLQLQESSTT VNMKGGFIDE CEDVKPVEEI SNEFEHHDGF  240
VEDSKLDLPS AQFIVSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585108.10.0PREDICTED: LOB domain-containing protein 22
RefseqXP_013728511.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-150LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A078J0750.0A0A078J075_BRANA; BnaCnng28570D protein
TrEMBLA0A0D3CKG30.0A0A0D3CKG3_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.3__1489__AT3G13850.11e-148(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-144LOB domain-containing protein 22
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]